PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G147600.1
Common NamePHAVU_007G147600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 313aa    MW: 34025.1 Da    PI: 8.0792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G147600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-161462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEde+l   ++++G+g +W + +++ g++R++k+c++rw++yl
  Phvul.007G147600.1 14 KGPWSPEEDEKLRGFIEKHGTGgNWISLPHKAGLKRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding35.52.3e-1169111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g ++++Ed ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
  Phvul.007G147600.1  69 GEFSEDEDRIICTLFGSIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                         789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.587962IPR017930Myb domain
SuperFamilySSF466893.36E-2711109IPR009057Homeodomain-like
SMARTSM007171.9E-111364IPR001005SANT/Myb domain
PfamPF002498.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-231569IPR009057Homeodomain-like
CDDcd001673.94E-91662No hitNo description
PROSITE profilePS5129421.07963117IPR017930Myb domain
SMARTSM007172.0E-1167115IPR001005SANT/Myb domain
PfamPF002493.6E-1069111IPR001005SANT/Myb domain
CDDcd001673.54E-870113No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDEKLRGFIE KHGTGGNWIS LPHKAGLKRC GKSCRLRWLN  60
YLRPNLKHGE FSEDEDRIIC TLFGSIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKMVGT  120
MNPSALKKPH QVTLSSMLQN STPSSSSSSS SFSLKNNHNS NYQQPYVPFT GSEAISYASL  180
LSGNSSSTPA CSSFERLYQV NCGFMLGGET SCSSSSDGSC KKNQMSDVKE GEVGYVGVGG  240
FGDQIGGLSY LSSGVEDTQK LVSSNAGRAS GWTGEESPLD YGLEEIKQLM STGSCNNFMF  300
DDSKTGEMVM YY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312651e-149KT031265.1 Glycine max clone HN_CCL_53 MYB/HD-like transcription factor (Glyma13g20510.1_like1) mRNA, partial cds.
GenBankKT0312661e-149KT031266.1 Glycine max clone HN_CCL_52 MYB/HD-like transcription factor (Glyma13g20510.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144336.10.0hypothetical protein PHAVU_007G147600g
TrEMBLV7BFK10.0V7BFK1_PHAVU; Uncharacterized protein
STRINGGLYMA10G06190.11e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.12e-74MYB family protein